PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_62573_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 80aa    MW: 9301.32 Da    PI: 9.7162
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_62573_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.91.1e-083370544
                                         -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
                      Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                                         + +E  l ++ +++ G + W++Ia +++ gR+++++k +w
  cra_locus_62573_iso_1_len_538_ver_3 33 SIDEVALMIRMHNLVGDR-WSLIAGRIP-GRSAEEIKKYW 70
                                         56788889999*****99.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00182876IPR001005SANT/Myb domain
SuperFamilySSF466898.58E-93175IPR009057Homeodomain-like
PROSITE profilePS500906.0983270IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.9E-113271IPR009057Homeodomain-like
PfamPF002491.7E-73270IPR001005SANT/Myb domain
CDDcd001675.05E-63570No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
XGRGDDRYFS GSQVSCQLQE GKTNRKESPV HFSIDEVALM IRMHNLVGDR WSLIAGRIPG  60
RSAEEIKKYW IWKKDAFKEQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012849300.18e-20PREDICTED: MYB-like transcription factor ETC1
TrEMBLA0A022QIM69e-20A0A022QIM6_ERYGU; Uncharacterized protein
STRINGVIT_10s0116g00500.t012e-17(Vitis vinifera)
STRINGPOPTR_0011s00390.12e-17(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA65791932